Pfam domain
Pfam family: Rho_N (PF07498.11)
Uniprot AC: P0AG32
RecName: Transcription termination factor Rho
Begin-End: 5-47
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
ELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGE
Structures of the domain P0AG32 5-47
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jjl X-ray 3.2 F 20-47 None
5jjl X-ray 3.2 E 30-44 None
5jjl X-ray 3.2 D 30-47 None
5jjl X-ray 3.2 C 5-47 None
5jjl X-ray 3.2 A 30-47 None
5jjl X-ray 3.2 B 20-47 None
5jji X-ray 2.6 F 20-47 None
5jji X-ray 2.6 E 30-47 None
5jji X-ray 2.6 D 30-47 None
5jji X-ray 2.6 C 5-47 None
5jji X-ray 2.6 B 20-47 None
5jji X-ray 2.6 A 30-47 None
5jjk X-ray 3.15 F 20-46 None
5jjk X-ray 3.15 D 31-47 None
5jjk X-ray 3.15 A 30-47 None
5jjk X-ray 3.15 B 20-47 None
5jjk X-ray 3.15 C 30-47 None


© NPIDB team 2003 - 2019

text