Pfam domain
Pfam family: Ribosomal_L17 (PF01196.18)
Uniprot AC: P0AG44
RecName: 50S ribosomal protein L17
Begin-End: 20-116
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MFRNMAGSLVRHEIIKTTLPKAKELRRVVEPLITLAKTDSVANRRLAFARTRDNEIVAKL
FNELGPRFASRAGGYTRILKCGFRAGDNAPMAYIELV
Structures of the domain P0AG44 20-116
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gag X-ray 3.8 O 20-116 None
5aka X-ray 5.7 N 20-116 None
3j8g X-ray 5 N 20-116 None
5gae X-ray 3.33 O 20-116 None
5gah X-ray 3.8 O 20-116 None
5gad X-ray 3.7 O 20-116 None
4csu X-ray 5.5 N 20-116 None
5gaf X-ray 4.3 O 20-116 None
5ady X-ray 4.5 N 20-116 None
4uy8 X-ray 3.8 N 20-116 None
2rdo X-ray 9.1 N 20-116 None
3j5l X-ray 6.6 N 20-116 None
3bbx X-ray 10 N 20-116 None
2j28 X-ray 8 N 20-116 None
3j7z X-ray 3.9 N 20-116 None


© NPIDB team 2003 - 2019

text