Pfam domain
Pfam family: Ribosomal_L6 (PF00347.22)
Uniprot AC: P0AG55
RecName: 50S ribosomal protein L6
Begin-End: 11-82
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VPAGVDVKINGQVITIKGKNGELTRTLNDAVEVKHADNTLTFGPRDGYADGWAQAGTARA
LLNSMVIGVTEG
Structures of the domain P0AG55 11-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gag X-ray 3.8 G 11-82 None
5aka X-ray 5.7 G 10-81 None
3j8g X-ray 5 G 10-81 None
5gae X-ray 3.33 G 11-82 None
5gah X-ray 3.8 G 11-82 None
5gad X-ray 3.7 G 11-82 None
4csu X-ray 5.5 G 9-80 None
5gaf X-ray 4.3 G 11-82 None
5ady X-ray 4.5 G 10-81 None
4uy8 X-ray 3.8 G 10-81 None
2rdo X-ray 9.1 G 10-81 None
3j5l X-ray 6.6 G 10-81 None
3bbx X-ray 10 G 10-81 None
2j28 X-ray 8 G 10-81 None
3j7z X-ray 3.9 G 10-81 None


© NPIDB team 2003 - 2019

text