Pfam domain
Pfam family: Ribosomal_S14 (PF00253.20)
Uniprot AC: P0AG59
RecName: 30S ribosomal protein S14
Begin-End: 47-100
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKAS
Structures of the domain P0AG59 47-100
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 N 47-100 None
5no4 X-ray 5.16 N 47-100 None
5no2 X-ray 5.16 N 47-100 None
2ykr X-ray 9.8 N 45-98 None
5uz4 X-ray 5.8 N 46-98 None
4a2i X-ray 16.5 N 46-99 None
4adv X-ray 13.5 N 46-99 None
5my1 X-ray 7.6 N 46-99 None


© NPIDB team 2003 - 2019

text