Pfam domain
Pfam family: RusA (PF05866.10)
Uniprot AC: P0AG74
RecName: Crossover junction endodeoxyribonuclease RusA
Begin-End: 9-115
Organism: Escherichia coli
Interaction Mode:  H-Bb L-Bb 

Sequence:
PWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNAMLDIGLAMPVKIRIECHMPDRRR
RDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTIT
Structures of the domain P0AG74 9-115
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2h8c X-ray 3.1 C 9-114  H-Bb L-Bb 
2h8c X-ray 3.1 D 10-114 None
2h8c X-ray 3.1 B 9-114  L-Bb 
2h8c X-ray 3.1 A 9-114 None


© NPIDB team 2003 - 2019

text