Pfam domain
Pfam family: SRP54 (PF00448.21)
Uniprot AC: P0AGD7
RecName: Signal recognition particle protein
Begin-End: 100-296
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDF
FPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLF
VVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKT
EALEPFHPDRIASRILG
Structures of the domain P0AGD7 100-296
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xxa X-ray 3.94 C 100-296 None
2xxa X-ray 3.94 A 100-296 None
4c7o X-ray 2.6 C 100-296 None
4c7o X-ray 2.6 A 100-296 None
5gad X-ray 3.7 i 100-296 None
5gaf X-ray 4.3 i 100-296 None
2j28 X-ray 8 9 100-296 None


© NPIDB team 2003 - 2019

text