Pfam domain
Pfam family: SRP_SPB (PF02978.18)
Uniprot AC: P0AGD7
RecName: Signal recognition particle protein
Begin-End: 371-427
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDDMQRMM
Structures of the domain P0AGD7 371-427
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1dul X-ray 1.8 A 9-80 None


© NPIDB team 2003 - 2019

text