Pfam domain
Pfam family: SRP54_N (PF02881.18)
Uniprot AC: P0AGD7
RecName: Signal recognition particle protein
Begin-End: 5-82
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEV
NKSLTPGQEFVKIVRNEL
Structures of the domain P0AGD7 5-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xxa X-ray 3.94 C 7-82 None
2xxa X-ray 3.94 A 5-82 None
4c7o X-ray 2.6 C 5-82 None
4c7o X-ray 2.6 A 5-82 None
5gad X-ray 3.7 i 5-82 None
5gaf X-ray 4.3 i 5-82 None
2j28 X-ray 8 9 5-82 None


© NPIDB team 2003 - 2019

text