Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P0C0S5
RecName: Histone H2A.Z
Begin-End: 17-94
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
AVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKD
LKVKRITPRHLQLAIRGD
Structures of the domain P0C0S5 17-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1f66 X-ray 2.6 G 1018-1093  H-Bb S-Bb L-Bb 
1f66 X-ray 2.6 C 818-893  H-Bb S-Bb L-Bb 
3wa9 X-ray 3.07 G 18-93  H-Bb S-Bb L-Bb 
3wa9 X-ray 3.07 C 17-93  H-Bb S-Bb L-Bb 
5b33 X-ray 2.93 C 18-93  H-Bb S-Bb L-Bb 
5b33 X-ray 2.93 G 18-93  H-Bb S-Bb L-Bb 
5b32 X-ray 2.35 G 18-93  H-Bb S-Bb L-Bb 
5b31 X-ray 2.2 G 18-93  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text