Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P0C0S8
RecName: Histone H2A type 1
Begin-End: 10-91
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGN
AARDNKKTRIIPRHLQLAIRND
Structures of the domain P0C0S8 10-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5kgf X-ray 4.54 G 13-88 None
5kgf X-ray 4.54 C 13-88 None


© NPIDB team 2003 - 2019

text