Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P0C0S9
RecName: Histone H2A type 1
Begin-End: 13-91
Organism: Bos taurus
Interaction Mode:   

Sequence:
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAAR
DNKKTRIIPRHLQLAIRND
Structures of the domain P0C0S9 13-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fml X-ray 4.34 S 16-88 None
6fml X-ray 4.34 O 19-88 None


© NPIDB team 2003 - 2019

text