Pfam domain
Pfam family: Ribosomal_S21e (PF01249.17)
Uniprot AC: P0C0V8
RecName: 40S ribosomal protein S21-A
Begin-End: 1-80
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
MENDKGQLVELYVPRKCSATNRIIKADDHASVQINVAKVDEEGRAIPGEYVTYALSGYVR
SRGESDDSLNRLAQNDGLLK
Structures of the domain P0C0V8 1-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 V 1-80 None
6eml X-ray 3.6 a 1-80 None


© NPIDB team 2003 - 2019

text