Pfam domain
Pfam family: Ribosomal_S8 (PF00410.18)
Uniprot AC: P0C0W1
RecName: 40S ribosomal protein S22-A
Begin-End: 5-130
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQ
LNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKHVSGK
ILGFVY
Structures of the domain P0C0W1 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 W 7-130 None
6eml X-ray 3.6 b 25-148 None
5tzs X-ray 5.1 E 8-130 None


© NPIDB team 2003 - 2019

text