Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P0C1H5
RecName: Histone H2B 7
Begin-End: 20-102
Organism: Gallus gallus
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
TKTQKKGDKKRKRARKESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEAS
RLAHYNKRSTITSREIQTAVRLL
Structures of the domain P0C1H5 20-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eqz X-ray 2.5 F 19-100  H-Bb S-Bb L-Bb 
1eqz X-ray 2.5 B 19-100  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text