Pfam domain
Pfam family: Ribosomal_L27e (PF01777.17)
Uniprot AC: P0C2H6
RecName: 60S ribosomal protein L27-A
Begin-End: 52-136
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KVTKKHGAKKVAKRTKIKPFIKVVNYNHLLPTRYTLDVEAFKSVVSTETFEQPSQREEAK
KVVKKAFEERHQAGKNQWFFSKLRF
Structures of the domain P0C2H6 52-136
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 Z 52-136 None


© NPIDB team 2003 - 2019

text