Pfam domain
Pfam family: Ribosomal_L31e (PF01198.18)
Uniprot AC: P0C2H8
RecName: 60S ribosomal protein L31-A
Begin-End: 9-87
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAPELNQAIWKRGVKGVE
YRLRLRISRKRNEEEDAKN
Structures of the domain P0C2H8 9-87
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2wwb X-ray 6.48 M 9-87 None
2wwa X-ray 8.9 M 9-87 None
2ww9 X-ray 8.6 M 9-87 None
6em5 X-ray 4.3 d 267-348 None


© NPIDB team 2003 - 2019

text