Pfam domain
Pfam family: AP_endonuc_2 (PF01261.26)
Uniprot AC: P0C9C6
RecName: Probable AP endonuclease
Begin-End: 29-284
Organism: African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996)
Interaction Mode:  S-Bb S-Mn L-Bb L-Mj L-Mn 

Sequence:
VAFGEQIGFPFKSAQVFIAGPRKAVINIQEDDKVELLKMIVKHNLWVVAHGTYLDVPWSR
RSAFVTHFIQQELLICKEVGIKGLVLHLGAVEPELIVEGLKKIKPVEGVVIYLETPHNKH
HTYKYSTMEQIKELFLRIRNTRLKQIGLCIDTAHIWSSGVNISSYNDAGQWLRSLENIHS
VIPPSHIMFHLNDAATECGSGIDRHASLFEGMIWKSYSHKIKQSGLYCFVEYITRHQCPA
ILERNLGSSMQLQTAL
Structures of the domain P0C9C6 29-284
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6khy X-ray 3.01 A 29-283  L-Bb L-Mj L-Mn 
6khy X-ray 3.01 C 29-283  L-Bb L-Mj L-Mn 
6khy X-ray 3.01 B 29-283 None
6khy X-ray 3.01 D 29-283 None
6ki3 X-ray 2.35 A 29-283  S-Bb L-Bb L-Mj L-Mn 
6ki3 X-ray 2.35 B 29-283  S-Bb S-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text