Pfam domain
Pfam family: ubiquitin (PF00240.25)
Uniprot AC: P0CH09
RecName: Ubiquitin-60S ribosomal protein L40
Begin-End: 3-74
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ
KESTLHLVLRLR
Structures of the domain P0CH09 3-74
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6px3 X-ray 4.1 C -69-2 None


© NPIDB team 2003 - 2021

text