Pfam domain
Pfam family: ribosomal_L24 (PF17136.3)
Uniprot AC: P0CI78
RecName: 50S ribosomal protein L24
Begin-End: 38-101
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
VNMVKKHSKPTQANPQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKS
GQVL
Structures of the domain P0CI78 38-101
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j3v X-ray 13.3 U 38-100 None
3j3w X-ray 10.7 U 38-100 None


© NPIDB team 2003 - 2019

text