Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: P0CL76
RecName: DNA polymerase 1
Begin-End: 20-133
Organism: Pyrococcus abyssi
Interaction Mode:   

Sequence:
KKEKGEFKVEYDRTFRPYIYALLKDDSAIDEVKKITAERHGKIVRITEVEKVQKKFLGRP
IEVWKLYLEHPQDVPAIREKIREHPAVVDIFEYDIPFAKRYLIDKGLTPMEGNE
Structures of the domain P0CL76 20-133
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4flu X-ray 3.1 A 24-129 None


© NPIDB team 2003 - 2020

text