Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: P0CL77
RecName: DNA polymerase 1
Begin-End: 20-133
Organism: Pyrococcus abyssi
Interaction Mode:   

Sequence:
KKEKGEFKVEYDRTFRPYIYALLKDDSAIDEVKKITAERHGKIVRITEVEKVQKKFLGRP
IEVWKLYLEHPQDVPAIREKIREHPAVVDIFEYDIPFAKRYLIDKGLTPMEGNE
Structures of the domain P0CL77 20-133
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4flw X-ray 2.15 A 24-129 None
4fm1 X-ray 3 A 24-129 None
4fm2 X-ray 2.9 A 24-129 None
4flz X-ray 3.2 A 24-129 None
4fm0 X-ray 3.12 A 24-129 None
4flx X-ray 2.9 A 24-129 None
4fly X-ray 2.3 A 24-129 None
4flt X-ray 2.9 A 24-129 None
4flv X-ray 2.7 A 24-129 None


© NPIDB team 2003 - 2019

text