Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.24)
Uniprot AC: P0CX29
RecName: 40S ribosomal protein S23-A
Begin-End: 31-144
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPND
GCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPR
Structures of the domain P0CX29 31-144
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 X 32-144 None
6eml X-ray 3.6 c 32-144 None


© NPIDB team 2003 - 2019

text