Pfam domain
Pfam family: Ribosomal_S24e (PF01282.18)
Uniprot AC: P0CX31
RecName: 40S ribosomal protein S24-A
Begin-End: 24-102
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VVDVLHPNRANVSKDELREKLAEVYKAEKDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAK
KFEPTYRLVRYGLAEKVEK
Structures of the domain P0CX31 24-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 Y 24-102 None
3j16 X-ray 7.2 D 24-102 None
6eml X-ray 3.6 d 24-102 None


© NPIDB team 2003 - 2019

text