Pfam domain
Pfam family: Ribosomal_S30 (PF04758.13)
Uniprot AC: P0CX33
RecName: 40S ribosomal protein S30-A
Begin-End: 7-61
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVNGKRRMNPGPS
Structures of the domain P0CX33 7-61
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 e 13-46 None
3j16 X-ray 7.2 E 7-58 None
6eml X-ray 3.6 g 3-58 None


© NPIDB team 2003 - 2019

text