Pfam domain
Pfam family: 40S_S4_C (PF16121.4)
Uniprot AC: P0CX35
RecName: 40S ribosomal protein S4-A
Begin-End: 212-259
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DSLDNTFVTRLNNVFVIGEQGKPYISLPKGKGIKLSIAEERDRRRAQQ
Structures of the domain P0CX35 212-259
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 E 212-259 None
6eml X-ray 3.6 S 212-259 None
5tzs X-ray 5.1 5 212-259 None


© NPIDB team 2003 - 2019

text