Pfam domain
Pfam family: S4 (PF01479.24)
Uniprot AC: P0CX35
RecName: 40S ribosomal protein S4-A
Begin-End: 42-90
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LPLIVFLRNRLKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVI
Structures of the domain P0CX35 42-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 E 43-90 None
6eml X-ray 3.6 S 43-90 None
5tzs X-ray 5.1 5 43-90 None


© NPIDB team 2003 - 2019

text