Pfam domain
Pfam family: Ribosomal_S4e (PF00900.19)
Uniprot AC: P0CX35
RecName: 40S ribosomal protein S4-A
Begin-End: 95-169
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TNENFRLVYDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPNI
KVNDTVKIDLASGKI
Structures of the domain P0CX35 95-169
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 E 95-169 None
6eml X-ray 3.6 S 95-169 None
5tzs X-ray 5.1 5 95-169 None


© NPIDB team 2003 - 2019

text