Pfam domain
Pfam family: Ribosomal_S6e (PF01092.18)
Uniprot AC: P0CX37
RecName: 40S ribosomal protein S6-A
Begin-End: 1-126
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
MKLNISYPVNGSQKTFEIDDEHRIRVFFDKRIGQEVDGEAVGDEFKGYVFKISGGNDKQG
FPMKQGVLLPTRIKLLLTKNVSCYRPRRDGERKRKSVRGAIVGPDLAVLALVIVKKGEQE
LEGLTD
Structures of the domain P0CX37 1-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 G 1-126 None
3j16 X-ray 7.2 C 1-126 None
6eml X-ray 3.6 T 45-170 None
5tzs X-ray 5.1 3 1-126 None


© NPIDB team 2003 - 2019

text