Pfam domain
Pfam family: Ribosomal_S8e (PF01201.21)
Uniprot AC: P0CX39
RecName: 40S ribosomal protein S8-A
Begin-End: 2-184
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGGNKKYRALRIE
TGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAIVQIDATPFRQWFEAHYGQTL
GKKKNVKEEETVAKSKNAERKWAARAASAKIESSVESQFSAGRLYACISSRPGQSGRCDG
YIL
Structures of the domain P0CX39 2-184
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 I 205-376 None
6eml X-ray 3.6 V 2-184 None
5tzs X-ray 5.1 8 2-184 None


© NPIDB team 2003 - 2019

text