Pfam domain
Pfam family: Ribosomal_L14 (PF00238.18)
Uniprot AC: P0CX41
RecName: 60S ribosomal protein L23-A
Begin-End: 17-137
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKKGKPELRKKVMPA
IVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLWPRVASNSGVV
V
Structures of the domain P0CX41 17-137
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j16 X-ray 7.2 I 19-136 None
6em4 X-ray 4.1 V 10-222 None
6em5 X-ray 4.3 V 18-136 None
2x7n X-ray 11.8 C 14-131 None


© NPIDB team 2003 - 2019

text