Pfam domain
Pfam family: Ribosomal_S17 (PF00366.19)
Uniprot AC: P0CX47
RecName: 40S ribosomal protein S11-A
Begin-End: 73-141
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPIS
KTVRFNVVK
Structures of the domain P0CX47 73-141
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 L 69-152 None
6eml X-ray 3.6 X 73-141 None
5tzs X-ray 5.1 D 73-141 None


© NPIDB team 2003 - 2019

text