Pfam domain
Pfam family: Ribosomal_S17_N (PF16205.4)
Uniprot AC: P0CX47
RecName: 40S ribosomal protein S11-A
Begin-End: 8-71
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIR
GKIL
Structures of the domain P0CX47 8-71
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 L 4-67 None
5ll6 X-ray 3.9 X 8-71 None
6rbe X-ray 3.8 L 8-71 None
6rbd X-ray 3.47 L 15-78 None
5tzs X-ray 5.1 D 94-175 None
6eml X-ray 3.6 X 8-71 None


© NPIDB team 2003 - 2020

text