Pfam domain
Pfam family: Ribosomal_L18 (PF17135.3)
Uniprot AC: P0CX49
RecName: 60S ribosomal protein L18-A
Begin-End: 15-148
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
HRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKALFLSKINRPPVSVSRIARALKQE
GAANKTVVVVGTVTDDARIFEFPKTTVAALRFTAGARAKIVKAGGECITLDQLAVRAPKG
QNTLILRGPRNSRE
Structures of the domain P0CX49 15-148
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 Q 15-145 None
6em3 X-ray 3.2 Q 15-145 None
6em5 X-ray 4.3 Q 15-148 None


© NPIDB team 2003 - 2019

text