Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: P0CX51
RecName: 40S ribosomal protein S16-A
Begin-End: 11-143
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFSNIDIRVRVT
GGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFG
GKGARSRFQKSYR
Structures of the domain P0CX51 11-143
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6eml X-ray 3.6 F 10-143 None


© NPIDB team 2003 - 2019

text