Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: P0CX53
RecName: 60S ribosomal protein L12-A
Begin-End: 7-69
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGEDIAKATKEFKGIKVTVQLKIQN
RQA
Structures of the domain P0CX53 7-69
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j16 X-ray 7.2 H 14-69 None


© NPIDB team 2003 - 2019

text