Pfam domain
Pfam family: Ribosomal_S13 (PF00416.21)
Uniprot AC: P0CX55
RecName: 40S ribosomal protein S18-A
Begin-End: 16-131
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKADVDLHKRAGELTQEELERIVQIMQN
PTHYKIPAWFLNRQNDITDGKDYHTLANNVESKLRDDLERLKKIRAHRGIRHFWGL
Structures of the domain P0CX55 16-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6eml X-ray 3.6 H 16-131 None


© NPIDB team 2003 - 2020

text