Pfam domain
Pfam family: Ribosomal_S13 (PF00416.21)
Uniprot AC: P0CX55
RecName: 40S ribosomal protein S18-A
Begin-End: 16-136
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKADVDLHKRAGELTQEELERIVQIMQN
PTHYKIPAWFLNRQNDITDGKDYHTLANNVESKLRDDLERLKKIRAHRGIRHFWGLRVRG
Q
Structures of the domain P0CX55 16-136
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 S 16-136 None


© NPIDB team 2003 - 2019

text