Pfam domain
Pfam family: Homeobox (PF00046.28)
Uniprot AC: P0CY08
RecName: Mating-type protein ALPHA2
Begin-End: 132-189
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT
Structures of the domain P0CY08 132-189
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1apl X-ray 2.7 D 135-188  H-Bb H-Mj L-Bb L-Mn 
1apl X-ray 2.7 C 135-188  H-Bb H-Mj L-Bb L-Mn 
1le8 X-ray 2.3 B 135-188  H-Bb H-Mj L-Bb L-Mn 
1k61 X-ray 2.1 D 135-188  H-Bb H-Mj 
1k61 X-ray 2.1 C 135-188  H-Bb H-Mj L-Bb 
1k61 X-ray 2.1 B 135-188  H-Bb L-Mn 
1k61 X-ray 2.1 A 135-188  H-Bb H-Mj L-Bb 
1yrn X-ray 2.5 B 135-188  H-Bb H-Mj L-Bb L-Mn 
1akh X-ray 2.5 B 135-188  H-Bb H-Mj L-Bb L-Mn 
1mnm X-ray 2.25 D 135-188  H-Bb H-Mj L-Bb L-Mn 
1mnm X-ray 2.25 C 135-188  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2019

text