Pfam domain
Pfam family: Homeobox (PF00046.28)
Uniprot AC: P0CY10
RecName: Mating-type protein A1
Begin-End: 77-125
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj L-Mj 

Sequence:
ISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRS
Structures of the domain P0CY10 77-125
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1le8 X-ray 2.3 A 76-126  H-Bb H-Mj L-Mj 
1yrn X-ray 2.5 A 78-124  H-Bb H-Mj 
1akh X-ray 2.5 A 78-124  H-Bb H-Mj 


© NPIDB team 2003 - 2020

text