Pfam domain
Pfam family: DtxR (PF18357.3)
Uniprot AC: P0DJL7
RecName: Diphtheria toxin repressor
Begin-End: 147-225
Organism: Corynebacterium diphtheriae
Interaction Mode:   

Sequence:
VPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSH
NGKDVELIDDLAHTIRIEE
Structures of the domain P0DJL7 147-225
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1c0w X-ray 3.2 B 147-225 None


© NPIDB team 2003 - 2021

text