Pfam domain
Pfam family: Fe_dep_repress (PF01325.21)
Uniprot AC: P0DJL7
RecName: Diphtheria toxin repressor
Begin-End: 3-62
Organism: Corynebacterium diphtheriae
Interaction Mode:   

Sequence:
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSL
Structures of the domain P0DJL7 3-62
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ddn X-ray 3 D 3-62  H-Bb H-Mj L-Bb L-Mj 
1ddn X-ray 3 B 3-62  H-Bb H-Mj L-Bb L-Mj 
1ddn X-ray 3 C 3-62  H-Bb H-Mj L-Bb L-Mj 
1ddn X-ray 3 A 3-62  H-Bb H-Mj L-Bb L-Mj 
1c0w X-ray 3.2 B 3-62  H-Bb H-Mj L-Bb L-Mj 
1c0w X-ray 3.2 C 3-62  H-Bb H-Mj L-Bb L-Mj 
1c0w X-ray 3.2 A 3-62  H-Bb H-Mj L-Bb L-Mj 
1c0w X-ray 3.2 D 3-62  H-Bb H-Mj L-Bb L-Mj 
1f5t X-ray 3 D 4003-4062  H-Bb H-Mj L-Bb L-Mj 
1f5t X-ray 3 B 2003-2062  H-Bb H-Mj L-Bb L-Mj 
1f5t X-ray 3 C 3003-3062  H-Bb H-Mj L-Bb L-Mj 
1f5t X-ray 3 A 1003-1062  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text