Pfam domain
Pfam family: Fe_dep_repr_C (PF02742.17)
Uniprot AC: P0DJL7
RecName: Diphtheria toxin repressor
Begin-End: 65-134
Organism: Corynebacterium diphtheriae
Interaction Mode:   

Sequence:
TPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVS
RSPFGNPIPG
Structures of the domain P0DJL7 65-134
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1c0w X-ray 3.2 A 65-134 None
1c0w X-ray 3.2 B 65-134 None
1c0w X-ray 3.2 D 65-134 None
1c0w X-ray 3.2 C 65-134 None


© NPIDB team 2003 - 2021

text