Pfam domain
Pfam family: Response_reg (PF00072.23)
Uniprot AC: P0DMC7
RecName: Transcriptional regulatory protein RcsB
Begin-End: 6-121
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYG
DGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALA
Structures of the domain P0DMC7 6-121
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vxn X-ray 3.38 B 6-120 None
5vxn X-ray 3.38 A 6-120 None
5vxn X-ray 3.38 D 6-120 None
5vxn X-ray 3.38 C 6-120 None
5w43 X-ray 3.15 B 6-120 None
5w43 X-ray 3.15 A 6-120 None


© NPIDB team 2003 - 2019

text