Pfam domain
Pfam family: T_Ag_DNA_bind (PF02217.15)
Uniprot AC: P0DOJ4
RecName: Large T antigen
Begin-End: 290-382
Organism: Murine polyomavirus
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
SDFPSSLTGYLSHAIYSNKTFPAFLVYSTKEKCKQLYDTIGKFRPEFKCLVHYEEGGMLF
FLTMTKHRVSAVKNYCSKLCSVSFLMCKAVTKP
Structures of the domain P0DOJ4 290-382
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4fb3 X-ray 3.79 A 291-382  H-Bb S-Bb S-Mj L-Bb L-Mj 
4fb3 X-ray 3.79 B 291-382  H-Bb S-Bb S-Mj L-Bb L-Mj 
4fb3 X-ray 3.79 E 291-382  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text