Pfam domain
Pfam family: SRP54_N (PF02881.18)
Uniprot AC: P10121
RecName: Signal recognition particle receptor FtsY
Begin-End: 215-275
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEE
M
Structures of the domain P10121 215-275
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xxa X-ray 3.94 D 22-80 None
2xxa X-ray 3.94 B 22-80 None


© NPIDB team 2003 - 2019

text