Pfam domain
Pfam family: SRP54 (PF00448.21)
Uniprot AC: P10121
RecName: Signal recognition particle receptor FtsY
Begin-End: 293-483
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVI
AQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAP
HEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIG
VGERIEDLRPF
Structures of the domain P10121 293-483
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gad X-ray 3.7 l 8-483 None


© NPIDB team 2003 - 2019

text