Pfam domain
Pfam family: SRP54 (PF00448.21)
Uniprot AC: P10121
RecName: Signal recognition particle receptor FtsY
Begin-End: 293-494
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVI
AQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAP
HEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIG
VGERIEDLRPFKADDFIEALFA
Structures of the domain P10121 293-494
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xxa X-ray 3.94 D 98-298 None
2xxa X-ray 3.94 B 98-298 None
4c7o X-ray 2.6 D 99-299 None
4c7o X-ray 2.6 B 99-299 None
3zn8 X-ray 12 D 293-493 None


© NPIDB team 2003 - 2019

text