Pfam domain
Pfam family: UDG (PF03167.18)
Uniprot AC: P10186
RecName: Uracil-DNA glycosylase
Begin-End: 163-324
Organism: Human herpesvirus 1
Interaction Mode:   

Sequence:
RYCTPDEVRVVIIGQDPYHHPGQAHGLAFSVRANVPPPPSLRNVLAAVKNCYPEARMSGH
GCLEKWARDGVLLLNTTLTVKRGAAASHSRIGWDRFVGGVIRRLAARRPGLVFMLWGTHA
QNAIRPDPRVHCVLKFSHPSPLSKVPFGTCQHFLVANRYLET
Structures of the domain P10186 163-324
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1lau X-ray 1.8 E 75-231 None


© NPIDB team 2003 - 2019

text