Pfam domain
Pfam family: zf-C4 (PF00105.20)
Uniprot AC: P10276
RecName: Retinoic acid receptor alpha
Begin-End: 87-155
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
PCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQ
KCFEVGMSK
Structures of the domain P10276 87-155
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1dsz X-ray 1.7 A 1134-1202  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
6xwg X-ray 2.4 D 86-155  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text