Pfam domain
Pfam family: DNA_pol3_alpha (PF07733.11)
Uniprot AC: P10443
RecName: DNA polymerase III subunit alpha
Begin-End: 290-558
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb 

Sequence:
DYLVKRAKEGLEERLAFLFPDEEERLKRRPEYDERLETELQVINQMGFPGYFLIVMEFIQ
WSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMPDFDVDFCME
KRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLIPPDPGM
TLAKAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLY
CDEEGKHPVTQFDKSDVEYAGLVKFDFLG
Structures of the domain P10443 290-558
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m1s X-ray 6.7 A 291-735  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2019

text